- Recombinant Human Proline-rich protein 24 (PRR24)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1176006
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 14,668 Da
- E Coli or Yeast
- 1-142
- InaF-motif containing 1
- Proline-rich protein 24 (PRR24)
- PRR24
Sequence
MRGTSCVGGGAESPGGAGLSEGPRGRWLRLAPVCAYFLCVSLAAVLLAVYYGLIWVPTRSPAAPAGPQPSAPSPPCAARPGVPPVPAPAAASLSCLLGVPGGPRPQLQLPLSRRRRYSDPDRRPSRQTPRETPEAAEGRRPG